PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr030136.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 324aa    MW: 35983.3 Da    PI: 7.7377
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr030136.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.1e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l+ +++++G g+W++ +++ g++R++k+c++rw++yl
      Pbr030136.1 15 RGPWTPEEDRKLLAYIQLHGHGSWRSLPQKAGLKRCGKSCRLRWRNYL 62
                     89*********************************************7 PP

2Myb_DNA-binding52.79.9e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++  Ed+ +++++++lG++ W++Ia++++ +Rt++++k++w+++l
      Pbr030136.1  68 RGNFSLHEDQTIIQLHALLGNR-WSAIAAHLP-RRTDNEVKNYWNSHL 113
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.4651062IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-241165IPR009057Homeodomain-like
SuperFamilySSF466896.47E-3112109IPR009057Homeodomain-like
SMARTSM007172.4E-151464IPR001005SANT/Myb domain
PfamPF002492.2E-171562IPR001005SANT/Myb domain
CDDcd001674.55E-121762No hitNo description
PROSITE profilePS5129425.10963117IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-2666117IPR009057Homeodomain-like
SMARTSM007173.1E-1667115IPR001005SANT/Myb domain
PfamPF002493.7E-1568113IPR001005SANT/Myb domain
CDDcd001672.38E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGKSSCHAAA SGIKRGPWTP EEDRKLLAYI QLHGHGSWRS LPQKAGLKRC GKSCRLRWRN  60
YLRPDIKRGN FSLHEDQTII QLHALLGNRW SAIAAHLPRR TDNEVKNYWN SHLKKRLAKI  120
GFDPVTHKPK AAILSSANGD PKNWSNLSHI AQWESARLQA EARSVKESKL RMHESAPAPS  180
LSDDHHQFAP PLVPQCLDIL RASAWESLIS MSRSSSRSAA QTNMNGQGNV SFGDHHHVHD  240
HGINMNAQDY GSNFEAPTSD QQLSSLMGYD DATLMSSVAT GSMDINELFG EYCGDECSEL  300
LAALHHDTGF EFGDAWTSLE QLM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26151177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009339145.10.0PREDICTED: myb-related protein Hv1-like
TrEMBLM5WDU61e-147M5WDU6_PRUPE; Uncharacterized protein (Fragment)
STRINGVIT_17s0000g06410.t017e-95(Vitis vinifera)
STRINGVIT_14s0108g01080.t019e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.29e-90myb domain protein 16